Result

Untitled Document

  Coagulation factor VII

SourceBos taurus (cattle)
Taxonomy Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos.
KeywordsBlood coagulation; Calcium; Cleavage on pair of basic residues; Direct protein sequencing; Disulfide bond; EGF-like domain; Gamma-carboxyglutamic acid; Glycoprotein; Hydrolase; Protease; Repeat; Secreted; Serine protease; Signal; Zymogen.
Details
Function: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.

Post-translational modification: The vitamin K-dependent, enzymatic carboxylation of some glutamate residues allows the modified protein to bind calcium.

Similarity: Belongs to the peptidase S1 family. Contains 2 EGF-like domains. Contains 1 Gla (gamma-carboxy-glutamate) domain. Contains 1 peptidase S1 domain.

Subcellular location: Secreted.

Subunit structure: Heterodimer of a light chain and a heavy chain linked by a disulfide bond.

Tissue specificity: Plasma.

Sequence length: 447 AA.

Sequence
MLSQAWALALLCFLLSLWGSLPAVFLPQEQALSILHRPRRANGFLEELLPGSLERECREE
LCSFEEAHEIFRNEERTRQFWVSYNDGDQCASSPCQNGGSCEDQLRSYICFCPDGFEGRN
CETDKQSQLICANDNGGCEQYCGADPGAGRFCWCHEGYALQADGVSCAPTVEYPCGKIPV
LEKRNGSKPQGRIVGGHVCPKGECPWQAMLKLNGALLCGGTLVGPAWVVSAAHCFERLRS
RGNLTAVLGEHDLSRVEGPEQERRVAQIIVPKQYVPGQTDHDVALLQLAQPVALGDHVAP
LCLPDPDFADQTLAFVRFSAVSGWGQLLERGVTARKLMVVLVPRLLTQDCLQQSRQRPGG
PVVTDNMFCAGYSDGSKDACKGDSGGPHATRFRGTWFLTGVVSWGEGCAAAGHFGIYTRV
SRYTAWLRQLMGHPPSRQGFFQVPLLP
Accession NumberP22457 
PubMed ID16305752, 3049594, 3149637, 2129367 
CTD DB617960
eggNOG DBmaNOG13655
Ensembl DBENSBTAT00000009746, ENSBTAT00000049854
GeneID DB617960, 785517
GO DB0005576, 0005509, 0004252, 0007596, 0006508
InterPro DBIPR002383, IPR006209, IPR006210, IPR013032, IPR000152, IPR001438, IPR000742, IPR001881, IPR018097, IPR000294, IPR012224, IPR018114, IPR001254, IPR001314, IPR009003
IPI DBIPI00713401
KEGGbta:617960, bta:785517
NCBIBT021584, AAX46431, BC146045, AAI46046
OMAVCPKGEC
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500
OrthoDBEOG9QRKPC
PfamPF00008, PF00594, PF00089
PROSITE DBPS00010, PS00022, PS01186, PS50026, PS01187, PS00011, PS50998, PS50240, PS00134, PS00135
SMART DBSM00181, SM00179, SM00069, SM00020
UniGeneBt.37397



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai