Result Untitled Document Coagulation factor VIIISourcePongo pygmaeus (Bornean orangutan) Taxonomy Pongo pygmaeus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pongo.DetailsFunction: Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa (By similarity). Similarity: Belongs to the multicopper oxidase family. Contains 3 F5/8 type A domains. Contains 2 F5/8 type C domains. Contains 6 plastocyanin-like domains. Subcellular location: Secreted, extracellular space (By similarity). Subunit structure: Interacts with vWF. vWF binding is essential for the stabilization of F8 in circulation (By similarity). Sequence length: 155 AA. SequencePLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMAVYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAAccession NumberQ2VF43 PubMed ID16020776 GO DB0005507, 0016491InterPro DBIPR011706, IPR008972NCBIDQ173564, ABB58723OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700PfamPF07731
Result
Coagulation factor VIII
Function: Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa (By similarity). Similarity: Belongs to the multicopper oxidase family. Contains 3 F5/8 type A domains. Contains 2 F5/8 type C domains. Contains 6 plastocyanin-like domains. Subcellular location: Secreted, extracellular space (By similarity). Subunit structure: Interacts with vWF. vWF binding is essential for the stabilization of F8 in circulation (By similarity). Sequence length: 155 AA.
PLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMAVYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHA
©Biomedical Informatics Centre, NIRRH, Mumbai