Result

Untitled Document

  Coagulation factor VIII

SourcePongo pygmaeus (Bornean orangutan)
Taxonomy Pongo pygmaeus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pongo.
Details
Function: Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa (By similarity).

Similarity: Belongs to the multicopper oxidase family. Contains 3 F5/8 type A domains. Contains 2 F5/8 type C domains. Contains 6 plastocyanin-like domains.

Subcellular location: Secreted, extracellular space (By similarity).

Subunit structure: Interacts with vWF. vWF binding is essential for the stabilization of F8 in circulation (By similarity).

Sequence length: 155 AA.

Sequence
PLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFK
ENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKM
AVYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHA
Accession NumberQ2VF43 
PubMed ID16020776 
GO DB0005507, 0016491
InterPro DBIPR011706, IPR008972
NCBIDQ173564, ABB58723
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700
PfamPF07731



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai