Result

Untitled Document

  Coagulation factor VII

SourceXenopus (Silurana) tropicalis (western clawed frog)
Taxonomy Xenopus (Silurana) tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
KeywordsHypothetical protein.
Details
Function: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.

Post-translational modification: The vitamin K-dependent, enzymatic carboxylation of some glutamate residues allows the modified protein to bind calcium. The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.

Similarity: Belongs to the peptidase S1 family. Contains 2 EGF-like domains. Contains 1 Gla (gamma-carboxy-glutamate) domain. Contains 1 peptidase S1 domain.

Subcellular location: Secreted.

Subunit structure: Heterodimer of a light chain and a heavy chain linked by a disulfide bond.

Tissue specificity: Plasma.

Disease: Defects in F7 are the cause of F7 deficiency

Interaction: P04133:PII (xeno); NbExp=1; IntAct=EBI-355972, EBI-1646019.

Alternative products: Event=Alternative splicing; Named isoforms=2; Name=A; IsoId=P08709-1; Sequence=Displayed; Name=B; IsoId=P08709-2; Sequence=VSP_005387.

Sequence length: 452 AA.

Sequence
MDPGHKKAFCFCFLMVLSYIPTFAEDASLAQLQDAAGGYRESADVFLQDKRAHSLLNSRK
RRANSFFEEFKAGSLERECIEEICSYEEAREIFQDDRRTKEYWKVYTDGDQCLSNPCMNG
GTCFDQHQSYICTCPMGYEGRHCETNLRDMLKCIYDNGQCEHFCHDNSSTSRQCSCAEGY
KLGADGLSCEPTVNYPCGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGT
LIAPNWVITAAHCLKPLPENKLTVVLGEHRIGTPEGTEQESKVSKIIMHEHYYGSKTNND
NDIALLKLTTPVNYTDYVVPLCLPEKQFAVQELLSIRYSTVSGWGRLLESGATPELLQRV
QLPRVKTQDCIRQTQMNISQNMFCAGYTDGSKDSCKGDSGGPHATQYKNTHFLTGIVSWG
LGCAKKEKYGVYTRVSRYTEWIKENMDEQPEA
Accession NumberQ0V9B6 
PubMed ID12454917, 12477932 
CATHG3DSA:4.10.740.10, G3DSA:2.10.25.10, G3DSA:2.40.10.10
InterPro DBIPR000152, IPR002383, IPR008985, IPR006210, IPR001438, IPR000742, IPR001881, IPR006209, IPR013032, IPR012224, IPR009003, IPR001254, IPR001314, IPR000294
NCBIBC121656, AAI21657
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500
PfamPF00008, PF00594, PF00089
PROSITE DBPS00010, PS00022, PS01186, PS50026, PS01187, PS00011, PS50998, PS50240, PS00134, PS00135
SMART DBSM00181, SM00179, SM00069, SM00020



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai