Result Untitled Document KallikreinSourceHomo sapiens (human) Taxonomy Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo.Keywords3D-structure; Blood coagulation; Complete proteome; Direct protein sequencing; Disease mutation; Disulfide bond; Fibrinolysis; Glycoprotein; Hydrolase; Inflammatory response; Polymorphism; Protease; Repeat; Secreted; Serine protease; Signal; Zymogen.DetailsFunction: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. Similarity: Belongs to the peptidase S1 family. Plasma kallikrein subfamily. Contains 4 apple domains. Contains 1 peptidase S1 domain. Subcellular location: Secreted. Subunit structure: The zymogen is activated by factor XIIa, which cleaves the molecule into a light chain, which contains the active site, and a heavy chain, which associates with HMW kininogen. These chains are linked by one or more disulfide bonds. Disease: Defects in KLKB1 are the cause of prekallikrein deficiency (PKK deficiency) Sequence length: 638 AA. SequenceMILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAAccession NumberP03952 PubMed ID3521732, 11031105, 14702039, 15489334, 1998666, 12754519, 16335952, 19159218, 14652634, 17598838 CEX DBHS_KLK3, HS_KLKB1CTD DB3818Ensembl DBENST00000264690Genecard DBGC04P187385GeneID DB3818GermOnline DBENSG00000164344GO DB0005737, 0005615, 0004252, 0007596, 0002542, 0042730, 0031639, 0051919, 0006508HGNC DB6371HOGENOM DBHBG281927HPA DBHPA005634InterPro DBIPR000177, IPR003014, IPR003609, IPR018114, IPR001254, IPR001314, IPR009003H-InvDBHIX0031513IPI DBIPI00654888KEGGhsa:3818NCBIM13143.2, AAA60153, AF232742, AAF79940, AF232734, AF232735, AF232736, AF232737, AF232738, AF232739, AF232740, AF232741, AK313378, BAG36176, AY190920, AAN84794, BC117349, AAI17350, BC117351, AAI17352, NP_000883.2OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423Orphanet DB749PDBKLKB1_HUMAN, 2ANW_A, 2ANY_APfamPF00024, PF00089PharmaGKBPA30160PROSITE DBPS00495, PS50948, PS50240, PS00134, PS00135SMART DBSM00223, SM00020UniGeneHs.237642
Result
Kallikrein
Function: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. Similarity: Belongs to the peptidase S1 family. Plasma kallikrein subfamily. Contains 4 apple domains. Contains 1 peptidase S1 domain. Subcellular location: Secreted. Subunit structure: The zymogen is activated by factor XIIa, which cleaves the molecule into a light chain, which contains the active site, and a heavy chain, which associates with HMW kininogen. These chains are linked by one or more disulfide bonds. Disease: Defects in KLKB1 are the cause of prekallikrein deficiency (PKK deficiency) Sequence length: 638 AA.
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
©Biomedical Informatics Centre, NIRRH, Mumbai