Result

  Kallikrein

Source	Rattus norvegicus (Norway rat)
Taxonomy	Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.
Keywords	Blood coagulation; Direct protein sequencing; Disulfide bond; Fibrinolysis; Glycoprotein; Hydrolase; Inflammatory response; Protease; Repeat; Secreted; Serine protease; Signal; Zymogen.
Details Function: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. Similarity: Belongs to the peptidase S1 family. Plasma kallikrein subfamily. Contains 4 apple domains. Contains 1 peptidase S1 domain. Subcellular location: Secreted. Subunit structure: The zymogen is activated by factor XIIa, which cleaves the molecule into a light chain, which contains the active site, and a heavy chain, which associates with HMW kininogen. These chains are linked by one or more disulfide bonds. Sequence length: 638 AA.
Sequence MILFKQVGYFVSLFATVSCGCLSQLYANTFFRGGDLAAIYTPDAQHCQKMCTFHPRCLLF SFLAVSPTKETDKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQLSACHQDIYEGLD MRGSNFNISKTDSIEECQKLCTNNIHCQFFTYATKAFHRPEYRKSCLLKRSSSGTPTSIK PVDNLVSGFSLKSCALSEIGCPMDIFQHFAFADLNVSQVVTPDAFVCRTVCTFHPNCLFF TFYTNEWETESQRNVCFLKTSKSGRPSPPIIQENAVSGYSLFTCRKARPEPCHFKIYSGV AFEGEELNATFVQGADACQETCTKTIRCQFFTYSLLPQDCKAEGCKCSLRLSTDGSPTRI TYEAQGSSGYSLRLCKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCG GSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEG SYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATI PLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGE GCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
Accession Number	P14272
PubMed ID	1993180, 2598771
eggNOG DB	roNOG08709
Ensembl DB	ENSRNOT00000019237
GermOnline DB	ENSRNOG00000014118
GO DB	0004252, 0007596, 0042730, 0006954, 0006508
InterPro DB	IPR000177, IPR003014, IPR003609, IPR018114, IPR001254, IPR001314, IPR009003
IPI DB	IPI00203384
NCBI	M62357, AAA74563, M62358, M62346, M62347, M62349, M62350, M62351, M62352, M62353, M62354, M62355, M62356, M30282, AAA41463, M58590, AAA42069
OMIM	105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423
Pfam	PF00024, PF00089
PROSITE DB	PS00495, PS50948, PS50240, PS00134, PS00135
SMART DB	SM00223, SM00020
UCSC	NM_012725
UniGene	Rn.9880