Result

Untitled Document

  Protein C

SourceSus scrofa (pig)
Taxonomy Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
KeywordsBlood coagulation; Calcium; Cleavage on pair of basic residues; Disulfide bond; EGF-like domain; Gamma-carboxyglutamic acid; Glycoprotein; Hydrolase; Hydroxylation; Protease; Repeat; Serine protease; Signal; Zymogen.
Details
Function: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

Post-translational modification: The vitamin K-dependent, enzymatic carboxylation of some Glu residues allows the modified protein to bind calcium. The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains (By similarity).

Similarity: Belongs to the peptidase S1 family. Contains 2 EGF-like domains. Contains 1 Gla (gamma-carboxy-glutamate) domain. Contains 1 peptidase S1 domain.

Subunit structure: Synthesized as a single chain precursor, which is cleaved into a light chain and a heavy chain held together by a disulfide bond. The enzyme is then activated by thrombin, which cleaves a tetradecapeptide from the amino end of the heavy chain; this reaction, which occurs at the surface of endothelial cells, is strongly promoted by thrombomodulin.

Tissue specificity: Plasma; synthesized in the liver.

Sequence length: 459 AA.

Sequence
MWQLASLLLLLIIWAVSSTPVPPDSVFSSSQRAHQMLRSKRANSFLEELRPSSLERECKE
ETCDFEEAREIFQNTENTMAFWSKYHDGDQCAVSPPEHLCDSPCCGRGTCIDGLGGFRCD
CAQGWEGRFCLHEVRFSNCSTENGGCAHYCLEEEGGRRCACAPGYRLGDDHLQCEPKVRS
PCGRLGNRMEKKRKNLKRDTDQVDKKEDQIDPRLVNGKQSPWGESPWQVILLDSKKKLAC
GAVLIHVSWVLTAAHCLDDYKKLTVRLGEYDLRRREKWEVDLDIKEFLVHPNYTRSTSDN
DIALLRLAEPATFSQTIVPICLPDSGLSERELTRVGQETVVTGWGYRSEAKTNRSFILNF
IKVPVAPHNECVQAMHNKISENMLCAGILGDSRDACEGDSGGPMVASFRGTWFLVGLVSW
GEGCGRLHNYGVYTKVSRYLDWIHGHIRMEEAFHKNQVP
Accession NumberQ9GLP2 
PubMed ID11229814 
CTD DB396954
GeneID DB396954
GO DB0005576, 0005509, 0004252, 0007596, 0043066, 0006508
InterPro DBIPR002383, IPR006209, IPR006210, IPR013032, IPR000152, IPR000742, IPR018097, IPR000294, IPR012224, IPR018114, IPR001254, IPR001314, IPR009003
KEGGssc:396954
NCBIAF191307, AAG28380, NP_999083
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304
PfamPF00008, PF00594, PF00089
PROSITE DBPS00010, PS00022, PS01186, PS50026, PS01187, PS00011, PS50998, PS50240, PS00134, PS00135
SMART DBSM00181, SM00069, SM00020
UniGeneSsc.2763



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai