Result Untitled Document Coagulation factor XIII A chainSourceBos taurus (cattle) Taxonomy Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos.KeywordsAcetylation; Acyltransferase; Blood coagulation; Calcium; Cytoplasm; Direct protein sequencing; Secreted; Transferase; Zymogen.DetailsFunction: Factor XIII is activated by thrombin and calcium ion to a transglutaminase that catalyzes the formation of gamma-glutamyl-epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. Also cross-link alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Post-translational modification: The activation peptide is released by thrombin. Similarity: Belongs to the transglutaminase superfamily. Transglutaminase family. Subcellular location: Cytoplasm. Secreted. Note=Secreted into the blood plasma. Cytoplasmic in most tissues, but also secreted in the blood plasma. Subunit structure: Tetramer of two A chains and two B chains. Sequence length: 198 AA. SequenceMSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDSNKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPVPLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETDTYILFNPWCEEDAVYLENAccession NumberP12260 PubMed ID16305752, 4831071 eggNOG DBmaNOG14528Ensembl DBENSBTAT00000009559CATHG3DSA:2.60.40.10GO DB0005737, 0005576, 0008415, 0005509, 0003810, 0007596InterPro DBIPR013783, IPR014756, IPR001102IPI DBIPI00697215NCBIBT025350, ABF57306OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423, 107300, 188050PfamPF00868PROSITE DBPS00547UniGeneBt.19195
Result
Coagulation factor XIII A chain
Function: Factor XIII is activated by thrombin and calcium ion to a transglutaminase that catalyzes the formation of gamma-glutamyl-epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. Also cross-link alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Post-translational modification: The activation peptide is released by thrombin. Similarity: Belongs to the transglutaminase superfamily. Transglutaminase family. Subcellular location: Cytoplasm. Secreted. Note=Secreted into the blood plasma. Cytoplasmic in most tissues, but also secreted in the blood plasma. Subunit structure: Tetramer of two A chains and two B chains. Sequence length: 198 AA.
MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDSNKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPVPLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETDTYILFNPWCEEDAVYLEN
©Biomedical Informatics Centre, NIRRH, Mumbai