Result

Untitled Document

  Protein C

SourceOryctolagus cuniculus (rabbit)
Taxonomy Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus.
KeywordsBlood coagulation; Calcium; Cleavage on pair of basic residues; Disulfide bond; EGF-like domain; Gamma-carboxyglutamic acid; Glycoprotein; Hydrolase; Hydroxylation; Protease; Repeat; Serine protease; Signal; Zymogen.
Details
Function: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

Post-translational modification: The vitamin K-dependent, enzymatic carboxylation of some Glu residues allows the modified protein to bind calcium. The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains (By similarity).

Similarity: Belongs to the peptidase S1 family. Contains 2 EGF-like domains. Contains 1 Gla (gamma-carboxy-glutamate) domain. Contains 1 peptidase S1 domain.

Subunit structure: Synthesized as a single chain precursor, which is cleaved into a light chain and a heavy chain held together by a disulfide bond. The enzyme is then activated by thrombin, which cleaves a tetradecapeptide from the amino end of the heavy chain; this reaction, which occurs at the surface of endothelial cells, is strongly promoted by thrombomodulin.

Tissue specificity: Plasma; synthesized in the liver.

Sequence length: 458 AA.

Sequence
IPDDVGYRNQKTASKEGVCVVSKCQDGPNTLPRAKRANSFLEELRPSSLERECVEEVCDL
EEAKEIFQSVDDTLAFWYKYVDGDQCAALPSEHPCSSQCCGHGTCADSIGGFSCQCHGGW
EGSFCQYEVRFSNCSVDNGGCAHYCLEEEAGRSCSCAPGYELADDHLQCEPAVRFPCGRL
GWKRIEKKRGNVKRDLEQVDEMDEVDPRLIDGKLTRRGDSPWQVILLDSKKKLACGAVLI
HVSWVLTAAHCMEEPKKLFVRLGEYDLRRKERWELDLNIQEVLIHPNYSRSTTDNDIALL
RLAQPATLSQTIVPICLPDNGLAERELMQAGQETVVTGWGYHSSREKEAKRNRTFILNFI
TVPVAPQNECEQVMSNIISENMLCAGILGDRRDACDGDSGGPMVASFRGTWFLVGLVSWG
EGCGDLNNYGVYTKVSRYLDWIHSHIEEKEAAPESPAP
Accession NumberQ28661 
eggNOG DBmaNOG17466
Ensembl DBENSOCUT00000015843
GO DB0005576, 0005509, 0004252, 0007596, 0043066, 0006508
InterPro DBIPR002383, IPR006210, IPR013032, IPR000152, IPR000742, IPR018097, IPR000294, IPR012224, IPR018114, IPR001254, IPR001314, IPR009003
NCBIU49933, AAA92956
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304
PfamPF00594, PF00089
PROSITE DBPS00010, PS00022, PS01186, PS50026, PS01187, PS00011, PS50998, PS50240, PS00134, PS00135
SMART DBSM00181, SM00069, SM00020
UniGeneOcu.2057



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai