Result

  Antithrombin III

Source	Gallus gallus (chicken)
Taxonomy	Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Keywords	Blood coagulation; Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal.
Details Function: Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. Similarity: Belongs to the serpin family. Subcellular location: Secreted, extracellular space. Tissue specificity: Plasma. Sequence length: 105 AA.
Sequence MHLFIGVSLRPLGHGIPAPYAVEDICTAKPRDIPVNPICIYRNPEKKPQERRGAGAGEGQ DPGVHKPPASGSCPGPTRAFGRRSFLQAPGPTPRTMRRTSSCRPS
Accession Number	Q03352
PubMed ID	8424948, 6920385
GO DB	0005615, 0004867, 0007596
InterPro DB	IPR000215
IPI DB	IPI00579689
NCBI	L07842, AAA49075
OMIM	105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423, 107300, 188050
PROSITE DB	PS00284
UniGene	Gga.41117