Result

Untitled Document

  Coagulation factor IX

SourceSus scrofa (pig)
Taxonomy Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
Keywords3D-structure; Blood coagulation; Calcium; Direct protein sequencing; Disulfide bond; EGF-like domain; Gamma-carboxyglutamic acid; Glycoprotein; Hydrolase; Hydroxylation; Phosphoprotein; Protease; Repeat; Secreted; Serine protease; Sulfation; Zymogen.
Details
Function: Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca(2 ) ions, phospholipids, and factor VIIIa.

Post-translational modification: Activated by factor XIa, which excises the activation peptide (By similarity). The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.

Similarity: Belongs to the peptidase S1 family. Contains 2 EGF-like domains. Contains 1 Gla (gamma-carboxy-glutamate) domain. Contains 1 peptidase S1 domain.

Subcellular location: Secreted.

Subunit structure: Heterodimer of a light chain and a heavy chain; disulfide-linked.

Tissue specificity: Synthesized primarily in the liver and secreted in plasma.

Sequence length: 409 AA.

Sequence
YNSGKLEESFVRGNLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNPCLNG
GLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAP
DQKSCKPAVPFPCGRVSVSHSPTTLTRAEIIFSNMDYENSTEVEPILDSLTESNQSSDDF
IRIVGGENAKPGQFPWQVLLNGKIDAFCGGSIINEKWVVTAAHCIEPGVKITVVAGEYNT
EETEPTEQRRNVIRAIPHHSYNATVNKYSHDIALLELDEPLTLNSYVTPICIADKEYTNI
FLKFGSGYVSGWGRVFNRGRSATILQYLKVPLVDRATCLRSTKVTIYSNMFCAGFHEGGK
DSCLGDSGGPHVTEVEGTSFLTGIISWGEECAVKGKYGIYTKVSRYVNW
Accession NumberP16293 
PubMed ID2303254, 8856916, 3322404, 7568220 
GO DB0005576, 0005509, 0004252, 0007596, 0006508
InterPro DBIPR002383, IPR006209, IPR006210, IPR013032, IPR000152, IPR001438, IPR000742, IPR001881, IPR018097, IPR000294, IPR012224, IPR018114, IPR001254, IPR001314, IPR009003
NCBIU51135, AAA96318, M26235, AAA31031, X92427, CAA63155, X92593, CAA63337
OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900
PfamPF00008, PF00594, PF00089
PROSITE DBPS00010, PS00022, PS01186, PS50026, PS01187, PS00011, PS50998, PS50240, PS00134, PS00135
SMART DBSM00181, SM00179, SM00069, SM00020
UniGeneSsc.16252



Useful Links

©Biomedical Informatics Centre, NIRRH, Mumbai