Result Untitled Document von Willebrand factorSourceOryctolagus cuniculus (rabbit) Taxonomy Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus.DetailsFunction: Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex, glycoprotein Ibalpha/IX/V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma (By similarity). Post-translational modification: All cysteine residues are involved in intrachain or interchain disulfide bonds (By similarity). N- and O-glycosylated (By similarity). Similarity: Contains 1 CTCK (C-terminal cystine knot-like) domain. Contains 1 pacifastin repeat. Contains 3 TIL (trypsin inhibitory-like) domains. Contains 3 VWFA domains. Contains 3 VWFC domains. Contains 3 VWFD domains. Subcellular location: Secreted (By similarity). Secreted, extracellular space, extracellular matrix (By similarity). Note=Localized to storage granules (By similarity). Subunit structure: Multimeric. Interacts with F8 (By similarity). Tissue specificity: Plasma. Sequence length: 366 AA. SequenceQEPGGMVVPPTDAPVRSTTPYMEDTPEPPLHDFYWSNLMDLVFLLDGSAQLSEAEFGVLKAFVVSVMERLHISQKRIRVAVVEYHDGSHSYISLKDRKRPSELRRIASQVKYAGGPVASTSEVLKYTLFHIFSNVDRPEASRIALLLSASQETPRMVRNLVRYAQGLKKEKVIVIPVGIGPHVSLRQIHLIEKQAPENKAFVLSGVDELEQRRDEIISYLCDLGPEAPVPTQRPPTARVTVSPGQLGVSPQGPKRCSMVLDVVFVLEGSDEVGEANFNKSKAFVEEVIRRMDVGPGSIHVTVLQYSYVVTVEYTFSEPQSKDDILRHVREIRYQGGNRTNTGLALQYLSEHSFTTSQGDREQAPNLAccession NumberQ28639 PubMed ID8673300 InterPro DBIPR002035NCBIU31618, AAB51555OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423, 107300, 188050, 134570, 134580, 193400, 277480PfamPF00092PROSITE DBPS50234SMART DBSM00327
Result
von Willebrand factor
Function: Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex, glycoprotein Ibalpha/IX/V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma (By similarity). Post-translational modification: All cysteine residues are involved in intrachain or interchain disulfide bonds (By similarity). N- and O-glycosylated (By similarity). Similarity: Contains 1 CTCK (C-terminal cystine knot-like) domain. Contains 1 pacifastin repeat. Contains 3 TIL (trypsin inhibitory-like) domains. Contains 3 VWFA domains. Contains 3 VWFC domains. Contains 3 VWFD domains. Subcellular location: Secreted (By similarity). Secreted, extracellular space, extracellular matrix (By similarity). Note=Localized to storage granules (By similarity). Subunit structure: Multimeric. Interacts with F8 (By similarity). Tissue specificity: Plasma. Sequence length: 366 AA.
QEPGGMVVPPTDAPVRSTTPYMEDTPEPPLHDFYWSNLMDLVFLLDGSAQLSEAEFGVLKAFVVSVMERLHISQKRIRVAVVEYHDGSHSYISLKDRKRPSELRRIASQVKYAGGPVASTSEVLKYTLFHIFSNVDRPEASRIALLLSASQETPRMVRNLVRYAQGLKKEKVIVIPVGIGPHVSLRQIHLIEKQAPENKAFVLSGVDELEQRRDEIISYLCDLGPEAPVPTQRPPTARVTVSPGQLGVSPQGPKRCSMVLDVVFVLEGSDEVGEANFNKSKAFVEEVIRRMDVGPGSIHVTVLQYSYVVTVEYTFSEPQSKDDILRHVREIRYQGGNRTNTGLALQYLSEHSFTTSQGDREQAPNL
©Biomedical Informatics Centre, NIRRH, Mumbai