Result Untitled Document PlasminogenSourcePongo abelii (Sumatran orangutan) Taxonomy Pongo abelii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pongo.KeywordsBlood coagulation; Disulfide bond; Fibrinolysis; Glycoprotein; Hydrolase; Kringle; Protease; Repeat; Secreted; Serine protease; Signal; Tissue remodeling; Zymogen.DetailsFunction: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation; in ovulation it weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. It cleaves fibrin, fibronectin, thrombospondin, laminin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Post-translational modification: In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide (By similarity). Similarity: Belongs to the peptidase S1 family. Plasminogen subfamily. Contains 5 kringle domains. Contains 1 PAN domain. Contains 1 peptidase S1 domain. Subcellular location: Secreted. Subunit structure: Interacts with CSPG4 (By similarity). Sequence length: 810 AA. SequenceMEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLRAGSIEECAAKCEEEKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDAQGPWCYTTDPEHRYDYCDIPECEEACMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWSAQTPQTHNRTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQVRWEYCKIPSCGSSPVSTEQLDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHQKTPENYPDAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEGSVVAPPPVVQLPNVETPSEEDCMFGNGKGYRGKRATTVTGTPCQEWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDEGGPWCYTTNPRKHYDYCDVPQCASSSFDCGKPQVEPKKCPGRVVGGCVANAHSWPWQVSLRTRFGTHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRADIALLKLSSPAVITDKVIPACLPSPNYVVAGRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNAccession NumberQ5R8X6 CTD DB100172984CATHG3DSA:2.40.20.10GeneID DB100172984GO DB0005509, 0004252, 0007596, 0042730, 0006508, 0048771InterPro DBIPR000001, IPR013806, IPR018056, IPR018059, IPR003014, IPR003609, IPR011358, IPR018114, IPR001254, IPR001314, IPR003966, IPR009003NCBICR859622, CAH91784OMIM105200, 134820, 202400, 134830, 202400, 134850, 202400, 176930, 601367, 134390, 188055, 227400, 600880, 601367, 612309, 227500, 134500, 306700, 300746, 306900, 227600, 176860, 188050, 612283, 612304, 176880, 612336, 264900, 612416, 234000, 610618, 610619, 229000, 612423, 107300, 188050, 134570, 134580, 193400, 277480, 228960, 612358, 176895, 173350, 188050, 217090PfamPF00051, PF00024, PF00089PROSITE DBPS00021, PS50070, PS50948, PS50240, PS00134, PS00135SMART DBSM00130, SM00473, SM00020UniGenePab.5478
Result
Plasminogen
Function: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation; in ovulation it weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. It cleaves fibrin, fibronectin, thrombospondin, laminin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Post-translational modification: In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide (By similarity). Similarity: Belongs to the peptidase S1 family. Plasminogen subfamily. Contains 5 kringle domains. Contains 1 PAN domain. Contains 1 peptidase S1 domain. Subcellular location: Secreted. Subunit structure: Interacts with CSPG4 (By similarity). Sequence length: 810 AA.
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLRAGSIEECAAKCEEEKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDAQGPWCYTTDPEHRYDYCDIPECEEACMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWSAQTPQTHNRTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQVRWEYCKIPSCGSSPVSTEQLDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHQKTPENYPDAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEGSVVAPPPVVQLPNVETPSEEDCMFGNGKGYRGKRATTVTGTPCQEWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDEGGPWCYTTNPRKHYDYCDVPQCASSSFDCGKPQVEPKKCPGRVVGGCVANAHSWPWQVSLRTRFGTHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRADIALLKLSSPAVITDKVIPACLPSPNYVVAGRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
©Biomedical Informatics Centre, NIRRH, Mumbai